Quick Guide
RAREPalm is developed to identify potential glycine and serine residues that may undergo palmitoylation. It extracts the peptides flanking all the Gly and Ser residues in a query protein sequence and shows that whether those peptides are palmitoylated or not. Prediction time may vary from 3-5 minutes based on protein's sequence length.
Making a query
Protein Sequence
RAREPalm needs protein sequences in fasta format. Example Sequence:
>P28112
SGSCQLKTCWQVSPDFRSVGDTLREKFQSALFLPLHNGHGGIGGLLVPRDTQLVYFERSP
TFCEQEDDIGSPGTRGRLCERTEQGFSGCSSMCCGRGHNVVRETRVERCNCKF
For each prediction cycle, please do not submit more than 5 sequences.
Prediction Threshold
User can adjust the threshold for prediction, however the recommended threshold value is 0.
Result Analysis
RAREPalm provides palmitoylation status of each Gly and Ser in a protein sequence. The result is displayed in following format: